| Name | C21ORF13 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3197 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C21ORF13 antibody was raised using the N terminal Of C21Orf13 corresponding to a region with amino acids SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY |
| Purity/Format | Affinity purified |
| Blocking Peptide | C21ORF13 Blocking Peptide |
| Description | Rabbit polyclonal C21ORF13 antibody raised against the N terminal Of C21Orf13 |
| Gene | LCA5L |
| Supplier Page | Shop |