| Name | WNT9B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7246 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WNT9B antibody was raised using the middle region of WNT9B corresponding to a region with amino acids CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA |
| Purity/Format | Affinity purified |
| Blocking Peptide | WNT9B Blocking Peptide |
| Description | Rabbit polyclonal WNT9B antibody raised against the middle region of WNT9B |
| Gene | WNT9B |
| Supplier Page | Shop |