| Name | RBM47 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4958 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM47 Blocking Peptide |
| Description | Rabbit polyclonal RBM47 antibody raised against the middle region of RBM47 |
| Gene | RBM47 |
| Supplier Page | Shop |