Copine IV antibody

Name Copine IV antibody
Supplier Fitzgerald
Catalog 70R-2844
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen Copine IV antibody was raised using the N terminal of CPNE4 corresponding to a region with amino acids EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY
Purity/Format Affinity purified
Blocking Peptide Copine IV Blocking Peptide
Description Rabbit polyclonal Copine IV antibody raised against the N terminal of CPNE4
Gene CPNE4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.