NSUN5C antibody

• Supplier: Fitzgerald
• Catalog: 70R-1208
• Prices: $275.00
• Sizes: 100 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: NSUN5C antibody was raised using the middle region of NSUN5C corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA
• Purity/Format: Total IgG Protein A purified
• Blocking Peptide: NSUN5C Blocking Peptide
• Description: Rabbit polyclonal NSUN5C antibody raised against the middle region of NSUN5C
• Gene: NSUN5P2