Name | NSUN5C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1208 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | NSUN5C antibody was raised using the middle region of NSUN5C corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | NSUN5C Blocking Peptide |
Description | Rabbit polyclonal NSUN5C antibody raised against the middle region of NSUN5C |
Gene | NSUN5P2 |
Supplier Page | Shop |