| Name | MAP2K3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2684 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MAP2K3 antibody was raised using the N terminal of MAP2K3 corresponding to a region with amino acids SKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEK |
| Purity/Format | Affinity purified |
| Blocking Peptide | MAP2K3 Blocking Peptide |
| Description | Rabbit polyclonal MAP2K3 antibody raised against the N terminal of MAP2K3 |
| Gene | MAP2 |
| Supplier Page | Shop |