Name | ENSA antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4510 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL |
Purity/Format | Affinity purified |
Blocking Peptide | ENSA Blocking Peptide |
Description | Rabbit polyclonal ENSA antibody raised against the N terminal of ENSA |
Gene | ENSA |
Supplier Page | Shop |