| Name | GAMT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2331 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GAMT antibody was raised using the middle region of GAMT corresponding to a region with amino acids PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI |
| Purity/Format | Affinity purified |
| Blocking Peptide | GAMT Blocking Peptide |
| Description | Rabbit polyclonal GAMT antibody raised against the middle region of GAMT |
| Gene | GAMT |
| Supplier Page | Shop |