Name | ALDH18A1 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2459 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ALDH18A1 antibody was raised using the N terminal of ALDH18A1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR |
Purity/Format | Affinity purified |
Blocking Peptide | ALDH18A1 Blocking Peptide |
Description | Rabbit polyclonal ALDH18A1 antibody raised against the N terminal of ALDH18A1 |
Gene | ALDH18A1 |
Supplier Page | Shop |