Name | PNKP antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4478 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | PNKP antibody was raised using the middle region of PNKP corresponding to a region with amino acids ALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTT |
Purity/Format | Affinity purified |
Blocking Peptide | PNKP Blocking Peptide |
Description | Rabbit polyclonal PNKP antibody raised against the middle region of PNKP |
Gene | PNKP |
Supplier Page | Shop |