| Name | ABP1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5440 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | ABP1 antibody was raised using the C terminal of ABP1 corresponding to a region with amino acids QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
| Purity/Format | Affinity purified |
| Blocking Peptide | ABP1 Blocking Peptide |
| Description | Rabbit polyclonal ABP1 antibody raised against the C terminal of ABP1 |
| Gene | DAO |
| Supplier Page | Shop |