C10ORF33 antibody

Name C10ORF33 antibody
Supplier Fitzgerald
Catalog 70R-3261
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C10ORF33 antibody was raised using the N terminal Of C10Orf33 corresponding to a region with amino acids MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAA
Purity/Format Affinity purified
Blocking Peptide C10ORF33 Blocking Peptide
Description Rabbit polyclonal C10ORF33 antibody raised against the N terminal Of C10Orf33
Gene PYROXD2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.