| Name | PTPRA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7310 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PTPRA antibody was raised using the C terminal of PTPRA corresponding to a region with amino acids SRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAG |
| Purity/Format | Affinity purified |
| Blocking Peptide | PTPRA Blocking Peptide |
| Description | Rabbit polyclonal PTPRA antibody raised against the C terminal of PTPRA |
| Gene | PTPRA |
| Supplier Page | Shop |