Name | PDGFD antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6220 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat |
Antigen | PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH |
Purity/Format | Affinity purified |
Blocking Peptide | PDGFD Blocking Peptide |
Description | Rabbit polyclonal PDGFD antibody raised against the N terminal of PDGFD |
Gene | PDGFD |
Supplier Page | Shop |