PDGFD antibody

Name PDGFD antibody
Supplier Fitzgerald
Catalog 70R-6220
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat
Antigen PDGFD antibody was raised using the N terminal of PDGFD corresponding to a region with amino acids NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH
Purity/Format Affinity purified
Blocking Peptide PDGFD Blocking Peptide
Description Rabbit polyclonal PDGFD antibody raised against the N terminal of PDGFD
Gene PDGFD
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.