| Name | RNASEH2A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1626 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Zebrafish |
| Antigen | RNASEH2A antibody was raised using the middle region of RNASEH2A corresponding to a region with amino acids AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RNASEH2A Blocking Peptide |
| Description | Rabbit polyclonal RNASEH2A antibody raised against the middle region of RNASEH2A |
| Gene | RNASEH2A |
| Supplier Page | Shop |