| Name | C1orf104 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3998 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C1orf104 antibody was raised using the middle region of C1orf104 corresponding to a region with amino acids APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1orf104 Blocking Peptide |
| Description | Rabbit polyclonal C1orf104 antibody raised against the middle region of C1orf104 |
| Gene | RUSC1-AS1 |
| Supplier Page | Shop |