Name | C1orf104 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3998 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C1orf104 antibody was raised using the middle region of C1orf104 corresponding to a region with amino acids APLSCPAPRAQVHRSTPMGRALLTRVLLEPLRPWACPRLPRSPPGGAQSG |
Purity/Format | Affinity purified |
Blocking Peptide | C1orf104 Blocking Peptide |
Description | Rabbit polyclonal C1orf104 antibody raised against the middle region of C1orf104 |
Gene | RUSC1-AS1 |
Supplier Page | Shop |