| Name | beta Actin antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2908 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, C. elegans, Drosophila |
| Antigen | beta Actin antibody was raised using the N terminal of ACTB corresponding to a region with amino acids PRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWH |
| Purity/Format | Affinity purified |
| Blocking Peptide | beta Actin Blocking Peptide |
| Description | Rabbit polyclonal beta Actin antibody raised against the N terminal of ACTB |
| Gene | POTEF |
| Supplier Page | Shop |