TPH2 antibody

Name TPH2 antibody
Supplier Fitzgerald
Catalog 70R-2011
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen TPH2 antibody was raised using the N terminal of TPH2 corresponding to a region with amino acids REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHIESRKSRRRSS
Purity/Format Affinity purified
Blocking Peptide TPH2 Blocking Peptide
Description Rabbit polyclonal TPH2 antibody raised against the N terminal of TPH2
Gene TPH2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.