MAGEB1 antibody

Name MAGEB1 antibody
Supplier Fitzgerald
Catalog 70R-4382
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MAGEB1 antibody was raised using the middle region of MAGEB1 corresponding to a region with amino acids EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRRTTATTFRARS
Purity/Format Affinity purified
Blocking Peptide MAGEB1 Blocking Peptide
Description Rabbit polyclonal MAGEB1 antibody raised against the middle region of MAGEB1
Gene MAGEB1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.