Name | FAM71A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4190 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM71A antibody was raised using the C terminal of FAM71A corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE |
Purity/Format | Affinity purified |
Blocking Peptide | FAM71A Blocking Peptide |
Description | Rabbit polyclonal FAM71A antibody raised against the C terminal of FAM71A |
Gene | FAM71A |
Supplier Page | Shop |