FAM71A antibody

Name FAM71A antibody
Supplier Fitzgerald
Catalog 70R-4190
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen FAM71A antibody was raised using the C terminal of FAM71A corresponding to a region with amino acids DKIAQKSSSRSSFSHRANRDDKKEKGCGNPGSSRHRDSHKGVSHTPISKE
Purity/Format Affinity purified
Blocking Peptide FAM71A Blocking Peptide
Description Rabbit polyclonal FAM71A antibody raised against the C terminal of FAM71A
Gene FAM71A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.