ZSWIM3 antibody

Name ZSWIM3 antibody
Supplier Fitzgerald
Catalog 70R-3646
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY
Purity/Format Affinity purified
Blocking Peptide ZSWIM3 Blocking Peptide
Description Rabbit polyclonal ZSWIM3 antibody raised against the N terminal of ZSWIM3
Gene ZSWIM3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.