| Name | FLJ22167 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1787 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | FLJ22167 Blocking Peptide |
| Description | Rabbit polyclonal FLJ22167 antibody raised against the N terminal of FLJ22167 |
| Gene | TMEM231 |
| Supplier Page | Shop |