| Name | Carbonic Anhydrase I antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2203 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS |
| Purity/Format | Affinity purified |
| Blocking Peptide | Carbonic Anhydrase I Blocking Peptide |
| Description | Rabbit polyclonal Carbonic Anhydrase I antibody raised against the N terminal of CA1 |
| Gene | CA1 |
| Supplier Page | Shop |