| Name | OCIAD2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3678 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OCIAD2 antibody was raised using the middle region of OCIAD2 corresponding to a region with amino acids QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFHFFEDQLRGAG |
| Purity/Format | Affinity purified |
| Blocking Peptide | OCIAD2 Blocking Peptide |
| Description | Rabbit polyclonal OCIAD2 antibody raised against the middle region of OCIAD2 |
| Gene | OCIAD2 |
| Supplier Page | Shop |