GNB2 antibody

Name GNB2 antibody
Supplier Fitzgerald
Catalog 70R-3133
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen GNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR
Purity/Format Affinity purified
Blocking Peptide GNB2 Blocking Peptide
Description Rabbit polyclonal GNB2 antibody
Gene GNB2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.