ZNF420 antibody

Name ZNF420 antibody
Supplier Fitzgerald
Catalog 70R-4414
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN
Purity/Format Affinity purified
Blocking Peptide ZNF420 Blocking Peptide
Description Rabbit polyclonal ZNF420 antibody raised against the N terminal of ZNF420
Gene ZNF420
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.