Name | KCNA10 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1497 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | KCNA10 Blocking Peptide |
Description | Rabbit polyclonal KCNA10 antibody raised against the middle region of KCNA10 |
Gene | KCNA10 |
Supplier Page | Shop |