| Name | CACNA1G antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5150 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CACNA1G antibody was raised using the middle region of CACNA1G corresponding to a region with amino acids VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS |
| Purity/Format | Affinity purified |
| Blocking Peptide | CACNA1G Blocking Peptide |
| Description | Rabbit polyclonal CACNA1G antibody raised against the middle region of CACNA1G |
| Gene | CACNA1G |
| Supplier Page | Shop |