| Name | LOC92270 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6828 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LOC92270 antibody was raised using the C terminal of LOC92270 corresponding to a region with amino acids LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS |
| Purity/Format | Affinity purified |
| Blocking Peptide | LOC92270 Blocking Peptide |
| Description | Rabbit polyclonal LOC92270 antibody raised against the C terminal of LOC92270 |
| Gene | ATP6AP1L |
| Supplier Page | Shop |