Name | LOC92270 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6828 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | LOC92270 antibody was raised using the C terminal of LOC92270 corresponding to a region with amino acids LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS |
Purity/Format | Affinity purified |
Blocking Peptide | LOC92270 Blocking Peptide |
Description | Rabbit polyclonal LOC92270 antibody raised against the C terminal of LOC92270 |
Gene | ATP6AP1L |
Supplier Page | Shop |