| Name | RNF182 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6668 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY |
| Purity/Format | Affinity purified |
| Blocking Peptide | RNF182 Blocking Peptide |
| Description | Rabbit polyclonal RNF182 antibody raised against the middle region of RNF182 |
| Gene | RNF182 |
| Supplier Page | Shop |