| Name | BDH2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4094 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | BDH2 antibody was raised using the middle region of BDH2 corresponding to a region with amino acids NRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQAR |
| Purity/Format | Affinity purified |
| Blocking Peptide | BDH2 Blocking Peptide |
| Description | Rabbit polyclonal BDH2 antibody raised against the middle region of BDH2 |
| Gene | BDH2 |
| Supplier Page | Shop |