| Name | ASL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1176 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | ASL antibody was raised using the middle region of ASL corresponding to a region with amino acids LILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGREDK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | ASL Blocking Peptide |
| Description | Rabbit polyclonal ASL antibody raised against the middle region of ASL |
| Gene | ASL |
| Supplier Page | Shop |