| Name | RPL37A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3004 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | RPL37A antibody was raised using the middle region of RPL37A corresponding to a region with amino acids CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD |
| Purity/Format | Affinity purified |
| Blocking Peptide | RPL37A Blocking Peptide |
| Description | Rabbit polyclonal RPL37A antibody raised against the middle region of RPL37A |
| Gene | RPL37A |
| Supplier Page | Shop |