| Name | GJD2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6161 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GJD2 antibody was raised using the middle region of GJD2 corresponding to a region with amino acids ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY |
| Purity/Format | Affinity purified |
| Blocking Peptide | GJD2 Blocking Peptide |
| Description | Rabbit polyclonal GJD2 antibody raised against the middle region of GJD2 |
| Gene | GJD2 |
| Supplier Page | Shop |