| Name | LRRC42 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4131 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | LRRC42 antibody was raised using the N terminal of LRRC42 corresponding to a region with amino acids LIGFPEQIAEKLFSAAEARQKFTEPGAGLRALQKFTEAYGSLVLCSLCLR |
| Purity/Format | Affinity purified |
| Blocking Peptide | LRRC42 Blocking Peptide |
| Description | Rabbit polyclonal LRRC42 antibody raised against the N terminal of LRRC42 |
| Gene | LRRC42 |
| Supplier Page | Shop |