| Name | METTL7A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1021 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | METTL7A antibody was raised using the N terminal of METTL7A corresponding to a region with amino acids MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | METTL7A Blocking Peptide |
| Description | Rabbit polyclonal METTL7A antibody raised against the N terminal of METTL7A |
| Gene | METTL7A |
| Supplier Page | Shop |