SUSD3 antibody

Name SUSD3 antibody
Supplier Fitzgerald
Catalog 70R-7091
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW
Purity/Format Affinity purified
Blocking Peptide SUSD3 Blocking Peptide
Description Rabbit polyclonal SUSD3 antibody raised against the N terminal of SUSD3
Gene SUSD3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.