TTC14 antibody

Name TTC14 antibody
Supplier Fitzgerald
Catalog 70R-4867
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK
Purity/Format Affinity purified
Blocking Peptide TTC14 Blocking Peptide
Description Rabbit polyclonal TTC14 antibody raised against the N terminal of TTC14
Gene TTC14
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.