| Name | DUT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1053 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | DUT antibody was raised using the C terminal of DUT corresponding to a region with amino acids NFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | DUT Blocking Peptide |
| Description | Rabbit polyclonal DUT antibody raised against the C terminal of DUT |
| Gene | DUT |
| Supplier Page | Shop |