| Name | PGRMC1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6737 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | PGRMC1 antibody was raised using the N terminal of PGRMC1 corresponding to a region with amino acids MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ |
| Purity/Format | Affinity purified |
| Blocking Peptide | PGRMC1 Blocking Peptide |
| Description | Rabbit polyclonal PGRMC1 antibody raised against the N terminal of PGRMC1 |
| Gene | PGRMC1 |
| Supplier Page | Shop |