| Name | FAM92B antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3362 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH |
| Purity/Format | Affinity purified |
| Blocking Peptide | FAM92B Blocking Peptide |
| Description | Rabbit polyclonal FAM92B antibody raised against the N terminal of FAM92B |
| Gene | FAM92B |
| Supplier Page | Shop |