| Name | SLC7A8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1792 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | SLC7A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC7A8 Blocking Peptide |
| Description | Rabbit polyclonal SLC7A8 antibody |
| Gene | SLC7A8 |
| Supplier Page | Shop |