Name | OMG antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6385 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | OMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN |
Purity/Format | Affinity purified |
Blocking Peptide | OMG Blocking Peptide |
Description | Rabbit polyclonal OMG antibody raised against the middle region of OMG |
Gene | OMG |
Supplier Page | Shop |