| Name | OMG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6385 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | OMG antibody was raised using the middle region of OMG corresponding to a region with amino acids NTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLTQILPGTLINLTN |
| Purity/Format | Affinity purified |
| Blocking Peptide | OMG Blocking Peptide |
| Description | Rabbit polyclonal OMG antibody raised against the middle region of OMG |
| Gene | OMG |
| Supplier Page | Shop |