| Name | KCNC4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5155 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KCNC4 antibody was raised using the middle region of KCNC4 corresponding to a region with amino acids NIDRNVTEILRVGNITSVHFRREVETEPILTYIEGVCVLWFTLEFLVRIV |
| Purity/Format | Affinity purified |
| Blocking Peptide | KCNC4 Blocking Peptide |
| Description | Rabbit polyclonal KCNC4 antibody raised against the middle region of KCNC4 |
| Gene | KCNC4 |
| Supplier Page | Shop |