RBPMS antibody

Name RBPMS antibody
Supplier Fitzgerald
Catalog 70R-4899
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RBPMS antibody was raised using the N terminal of RBPMS corresponding to a region with amino acids LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
Purity/Format Affinity purified
Blocking Peptide RBPMS Blocking Peptide
Description Rabbit polyclonal RBPMS antibody raised against the N terminal of RBPMS
Gene RBPMS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.