CHCHD3 antibody

Name CHCHD3 antibody
Supplier Fitzgerald
Catalog 70R-4355
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CHCHD3 antibody was raised using the N terminal of CHCHD3 corresponding to a region with amino acids RMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKR
Purity/Format Affinity purified
Blocking Peptide CHCHD3 Blocking Peptide
Description Rabbit polyclonal CHCHD3 antibody raised against the N terminal of CHCHD3
Gene CHCHD3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.