| Name | C16ORF48 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3266 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C16ORF48 antibody was raised using the C terminal Of C16Orf48 corresponding to a region with amino acids DLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKLLQSQSQLLRELV |
| Purity/Format | Affinity purified |
| Blocking Peptide | C16ORF48 Blocking Peptide |
| Description | Rabbit polyclonal C16ORF48 antibody raised against the C terminal Of C16Orf48 |
| Gene | ENKD1 |
| Supplier Page | Shop |