| Name | GLP2R antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5959 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GLP2R antibody was raised using the N terminal of GLP2R corresponding to a region with amino acids KLGSSRAGPGRGSAGLLPGVHELPMGIPAPWGTSPLSFHRKCSLWAPGRP |
| Purity/Format | Affinity purified |
| Blocking Peptide | GLP2R Blocking Peptide |
| Description | Rabbit polyclonal GLP2R antibody raised against the N terminal of GLP2R |
| Gene | GCG |
| Supplier Page | Shop |